PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 183aa    MW: 20372.9 Da    PI: 6.114
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029879.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB155.68.7e-49189896
        NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                 +Pianv+rim+++lP +akis+daket+qecvse+i+f+t+ea+++cqre+rkt++++d+lwa+++lGf++yvepl++yl++yre e+ 
  Pbr029879.1  1 MPIANVIRIMRRILPPHAKISDDAKETMQECVSEYIAFITGEANERCQREQRKTVTAEDVLWAMGKLGFDNYVEPLTIYLQRYRESESS 89
                 8************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.7E-461100IPR009072Histone-fold
SuperFamilySSF471132.17E-36199IPR009072Histone-fold
PfamPF008086.6E-25164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-162846No hitNo description
PRINTSPR006151.8E-164765No hitNo description
PRINTSPR006151.8E-166684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MPIANVIRIM RRILPPHAKI SDDAKETMQE CVSEYIAFIT GEANERCQRE QRKTVTAEDV  60
LWAMGKLGFD NYVEPLTIYL QRYRESESSN RSQFVKREER QLMDYYPPGH AGQVAMMPPP  120
PPSYGPGYYF GPQHGPPMYD PSMMGMFRDC SSSGDAGGGS SSASGAQGEN SLGRFDPFGH  180
FK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-36185892Transcription factor HapC (Eurofung)
4g92_B1e-36185892Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338979.11e-135PREDICTED: nuclear transcription factor Y subunit B-9-like
SwissprotQ9SFD83e-53NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLM5WRR41e-72M5WRR4_PRUPE; Uncharacterized protein (Fragment)
STRINGGLYMA03G18670.21e-54(Glycine max)
STRINGGLYMA17G00950.17e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-53nuclear factor Y, subunit B6